PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LFY
Protein Properties Length: 392aa    MW: 44358 Da    PI: 7.8251
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025645genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY605.69.9e-18513751384
      FLO_LFY   1 mdpeafsaslfkwdpraaaaapp..........arlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeeldd 88 
                  md  +  a + kwd+r+   app          +rl+e aav ++p + ++  ++r++++l elf+ayG+ry+t+akiaelGftv+tL+dm+deeld+
  DCAR_025645   1 MDRGNNEAFVIKWDTRNHCLAPPpppqppvtqpTRLYE-AAV-APPPAFSVGRENREVSGLVELFQAYGIRYYTAAKIAELGFTVNTLLDMRDEELDE 96 
                  67777788899***888774333234544442222222.222.2334677778888899*************************************** PP

      FLO_LFY  89 lmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekk 186
                  +m+sls+ifr+dllvGeryGika+vraerrrl++e+++++      + + taldalsqeglsee+vq+ekeaa+sgg+g  ++e++a+        kk
  DCAR_025645  97 MMNSLSQIFRWDLLVGERYGIKASVRAERRRLDDEDDSRRL----RQFHDTALDALSQEGLSEEHVQQEKEAAASGGGG--TWEAAASG-------KK 181
                  **********************************9944443....4566789***********************9999..88888776.......22 PP

      FLO_LFY 187 kaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnq 284
                  ++    +++k k++++s+ed++ ++++ +++++ +    erqrehPfivtepgevargkknGLDYLf+LyeqCrefL++vq+iake+GekcPtkvtnq
  DCAR_025645 182 QQ----RRKKAKSKISSMEDDEADSDRADHTKDDNVATVERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLVHVQSIAKEKGEKCPTKVTNQ 275
                  22....233333334455666666666666667777789*********************************************************** PP

      FLO_LFY 285 vfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChler 382
                  vfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrr +kergenvGawrqacykplvaiaa++gwdid +fn+hprLsiWYvPtkLrqLCh+er
  DCAR_025645 276 VFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRLYKERGENVGAWRQACYKPLVAIAAQKGWDIDLIFNTHPRLSIWYVPTKLRQLCHAER 373
                  ************************************************************************************************** PP

      FLO_LFY 383 sk 384
                  s 
  DCAR_025645 374 SC 375
                  85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016989.2E-1892375IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MDRGNNEAFV IKWDTRNHCL APPPPPQPPV TQPTRLYEAA VAPPPAFSVG RENREVSGLV  60
ELFQAYGIRY YTAAKIAELG FTVNTLLDMR DEELDEMMNS LSQIFRWDLL VGERYGIKAS  120
VRAERRRLDD EDDSRRLRQF HDTALDALSQ EGLSEEHVQQ EKEAAASGGG GTWEAAASGK  180
KQQRRKKAKS KISSMEDDEA DSDRADHTKD DNVATVERQR EHPFIVTEPG EVARGKKNGL  240
DYLFHLYEQC REFLVHVQSI AKEKGEKCPT KVTNQVFRYA KKAGASYINK PKMRHYVHCY  300
ALHCLDEEAS NALRRLYKER GENVGAWRQA CYKPLVAIAA QKGWDIDLIF NTHPRLSIWY  360
VPTKLRQLCH AERSCVAASA AATTGTHHLT F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1052163743161PROTEIN LEAFY
2vy2_A1e-1052163743161PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073600.10.0PREDICTED: LOW QUALITY PROTEIN: floricaula protein
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLM1L3050.0M1L305_9R
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-145floral meristem identity control protein LEAFY (LFY)